PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622679.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 903aa    MW: 101135 Da    PI: 5.7153
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622679.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.19.9e-30582633152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+le l++yF++++kdAAk++gvc+T+LKriCRqyGIkRWP+Rkik++
  XP_009622679.1 582 AEKTITLEILQQYFAGSLKDAAKSIGVCPTTLKRICRQYGIKRWPSRKIKKV 633
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.666570653IPR003035RWP-RK domain
PfamPF020423.7E-25585633IPR003035RWP-RK domain
SuperFamilySSF542775.4E-23798886No hitNo description
SMARTSM006663.9E-24802885IPR000270PB1 domain
PROSITE profilePS5174525.619802886IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.0E-21803881No hitNo description
CDDcd064071.40E-39804885No hitNo description
PfamPF005641.0E-18804883IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MDESVIPSNP LLTNQSDYLM DLDYMDGLLL EGCWLETTDG NEFMQNSPAT FNAPFDSSFM  60
WPNTIDTNSV DFSEIPSKDN QQEKQIQLFG ENVNNAMCTS GQSENHLVEA PELNRRWWIG  120
PKASSSVMDR LIWALGHIRD CSRDKDILLQ LWVPINRDGR RVLSTTDQPF LLDLNCPRLA  180
NYRQVSVNYQ FPANEDSKEI VGLPGRVFAD KVPEWSPDVR FFRSEEYPRV EHAQQYDVRG  240
TLAVPVFEQG SRNCLGVIEV VMTTQKIKYR PELESVCEAL EAVNLRTSEV STTQNAKECD  300
LSYQPALSEI LEVLKSACET HGLPLAQTWV PCVQQGKGGC RHSEENLIHC VSTEDSACYV  360
ADPHVRGFHE ACSEHHLLKG QGVVGRAFMT NQPCFSADLT SYSKTEYPLS HHAQMFGLQA  420
AVAIRLRSIS TGSCDFVLEF FLPSDCRNPE EHRRMLTSLS IIIQNVCRTL RVVTDKELQE  480
EAVSIGEAAN PSFIRSNKEH TETSQERTSW TSCDAEFQES STVVSAFQDE KPDETLRKEP  540
VEFRHHNDSG YGMNFALNEN RCASGEGVSR NGKKGDRRRT KAEKTITLEI LQQYFAGSLK  600
DAAKSIGVCP TTLKRICRQY GIKRWPSRKI KKVGHSLQKI QRVIDSVQGA SGSLQIESFY  660
SNFPVLASPN VSRLSPFADS MSNEHQKALN AQQEGCVMSP HAAASKSPSS SCSRSSSSSQ  720
CCSSGTKPQS SPLSIAGNDD PIVQEESVDN TVKRVKSEPE LHLSSEALKI LPRSQSHACV  780
AENPKSESLL VKKGPLRSQE EAPRVKVTHG EEKIRFRMQN SWRYSELLRE ITRRFGIDDP  840
SGLQLKYMDD DSEWVLLTCD ADLEECIDVC MSSQNQMIKL ILVRDSQHHI GSSFGSSSPI  900
LVQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622679.10.0PREDICTED: protein NLP5-like
RefseqXP_009622680.10.0PREDICTED: protein NLP5-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLM1ALT30.0M1ALT3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein